Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NCOA7 Polyclonal antibody, PBS Only

NCOA7 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 23092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

140 kDa estrogen receptor-associated protein, ERAP140, ESNA1, Nbla00052, Nbla10993

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

23092-1-PBS targets NCOA7 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19315

Product name: Recombinant human NCOA7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC137094

Sequence: MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVP

Predict reactive species
Full Name nuclear receptor coactivator 7
Calculated Molecular Weight 972 aa, 106 kDa
Observed Molecular Weight 120-130 kDa
GenBank Accession NumberBC137094
Gene Symbol NCOA7
Gene ID (NCBI) 135112
RRIDAB_2879208
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NI08
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nuclear receptors for steroids, thyroid hormones and retinoic acids are ligand-dependent transcription factors that activate transcription through specific DNA binding sites in their target genes. NCoA-7 (nuclear receptor coactivator 7), also known as ESNA1 or ERAP140, is a 942 amino acid nuclear protein that enhances nuclear receptor transcriptional activities and coactivates several nuclear receptors including PPARG, ESR1, THRB and RARA. Highly expressed in brain and weakly expressed in pancreas, bladder, ovary, spinal cord, prostate, mammary gland, ovary, uterus and stomach, NCoA-7 is a member of the OXR1 family and contains one LysM repeat and a TLD domain. This antibody is a rabbit polyclonal antibody raised against the N-terminal of human NCOA7 protein.

Loading...
||
New chat

Able

正在加载,请稍候...