NDRG2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67191-1-Ig (same clone as 67191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67191-1-Ig (NDRG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67191-1-Ig (same clone as 67191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67191-1-Ig (same clone as 67191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67191-1-Ig (same clone as 67191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67191-1-Ig (same clone as 67191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67191-1-PBS in a different storage buffer formulation.

NDRG2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67191-1-PBS

Clone No.3E3F4

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, Mouse, Pig

Applications

WB, IHC, Indirect ELISA

Synonyms

DKFZp781G1938, FLJ25522, KIAA1248, NDRG family member 2, NDRG2, Protein NDRG2, Protein Syld709613, SYLD

---

Product Information

67191-1-PBS targets NDRG2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Rat, Mouse, Pig samples.

• Tested Reactivity: Human, Rat, Mouse, Pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28612

  Product name: Recombinant human NDRG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-357 aa of BC010458

  Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

• Full Name: NDRG family member 2
• Calculated Molecular Weight: 371 aa, 39 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC010458
• Gene Symbol: NDRG2
• Gene ID (NCBI): 57447
• RRID: AB_2882486
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UN36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.