NDUFA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDUFA1 Polyclonal antibody (15561-1-AP)

NDUFA1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15561-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CI MWFE, CI-MWFE, Complex I MWFE, Complex I-MWFE, MWFE

• 

  WB analysis using 15561-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15561-1-AP (NDUFA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15561-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15561-1-AP (NDUFA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15561-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15561-1-AP (NDUFA1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15561-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15561-1-AP (NDUFA1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15561-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15561-1-AP (NDUFA1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15561-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15561-1-AP (NDUFA1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, rat heart tissue, mouse liver tissue
• Positive IHC detected in: mouse liver tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15561-1-AP targets NDUFA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7206

  Product name: Recombinant human NDUFA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC000266

  Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• Calculated Molecular Weight: 7.5 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC000266
• Gene Symbol: NDUFA1
• Gene ID (NCBI): 4694
• RRID: AB_2918040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15239
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Endocrinol (Lausanne); Changes and related factors of blood CCN1 levels in diabetic patients; Authors - Zhao-Yu Xiang
human	WB	Methods Mol Biol; Solvent-Induced Protein Precipitation for Drug Target Discovery; Authors - Xiaolei Zhang
rat	WB	Cell Death Dis; Homocysteine interferes with Ndufa1 leading to mitochondrial dysfunction through repression of the NAD+/Sirt1 pathway in the brain: a possible link between hyperhomocysteinemia and neurodegeneration; Authors - Gaoshang Chai
human	WB	Pharmacol Res; Discovery of KMT5A repressed miR-99b cluster with potential to restore chemotherapy sensitivity in gastric cancer by regulating mitochondrial complex II and affecting OXPHOS.; Authors - Liaoran Niu
mouse	WB	Phytomedicine; Kang Shuai Lao Pian exerts anti-aging effects by enhancing mitochondrial oxidative metabolism.; Authors - Xiaodan Wang
		Cell Signal; Salidroside alleviates age-related metaphase II oocyte aging by enhancing mitochondrial complex I-mediated oxidative phosphorylation.; Authors - Feimiao Wang