Product Information
17879-1-PBS targets NDUFA11 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11746 Product name: Recombinant human NDUFA11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-111 aa of BC069045 Sequence: MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIG Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa |
| Calculated Molecular Weight | 141 aa, 15 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC069045 |
| Gene Symbol | NDUFA11 |
| Gene ID (NCBI) | 126328 |
| RRID | AB_3669282 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86Y39 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Mitochondrial complex I is assembled from 44 subunits into an L-shaped complex, with a hydrophobic arm embedded in the inner mitochondrial membrane and the other arm protruding into the mitochondrial matrix. NDUFA11 encodes a subunit of the membrane-bound mitochondrial complex I, and functions in assembly, stability, and regulation of the complex. Mutations in NDUFA11 are associated with severe mitochondrial complex I deficiency(PMID: 18306244).
