NDUFA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDUFA2 Polyclonal antibody, PBS Only (15889-1-PBS)

• 

  WB analysis using 15889-1-AP (same clone as 15889-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15889-1-AP (NDUFA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15889-1-AP (same clone as 15889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15889-1-AP (NDUFA2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15889-1-AP (same clone as 15889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15889-1-AP (NDUFA2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15889-1-PBS in a different storage buffer formulation.

NDUFA2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15889-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15889-1-PBS targets NDUFA2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8675

  Product name: Recombinant human NDUFA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC003674

  Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
• Calculated Molecular Weight: 99 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC003674
• Gene Symbol: NDUFA2
• Gene ID (NCBI): 4695
• RRID: AB_3669223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFA2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2), also known as NADH ubiquinone oxidoreductase B8 subunit, is one of accessory subunits of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFS2 is vital for growth, ROS generation, membrane integrity, apoptosis, and mitochondrial energetics.