NDUFA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDUFA3 Polyclonal antibody, PBS Only (17257-1-PBS)

• 

  WB analysis of human brain using 17257-1-AP (same clone as 17257-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17257-1-AP (NDUFA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17257-1-AP (same clone as 17257-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17257-1-AP (NDUFA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17257-1-AP (same clone as 17257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17257-1-AP (NDUFA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 17257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17257-1-AP (same clone as 17257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17257-1-AP (NDUFA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 17257-1-PBS in a different storage buffer formulation.

NDUFA3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17257-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17257-1-PBS targets NDUFA3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10912

  Product name: Recombinant human NDUFA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-65 aa of BC011021

  Sequence: MAARVGAFLKNAWDKEPVLVVSFVVGGLEQSHDTTPRMLHDDPTLKRAHSMTNPTAASSRPHVSL

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
• Calculated Molecular Weight: 65aa,7 kDa; 84aa,9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC011021
• Gene Symbol: NDUFA3
• Gene ID (NCBI): 4696
• RRID: AB_2150631
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95167
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.