NDUFA9 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NDUFA9 Recombinant monoclonal antibody (87143-2-RR)

NDUFA9 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 87143-2-RR

Clone No.252374E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CI 39kD, CI-39kD, Complex I-39kD, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L

• 

  WB analysis using 87143-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87143-2-RR (NDUFA9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of Human lung cancer （Adenocarcinoma） using 87143-2-RR

  Immunohistochemical analysis of paraffin-embedded Human lung cancer (Adenocarcinoma) slide using 87143-2-RR (NDUFA9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 87143-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 87143-2-RR (NDUFA9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 87143-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NDUFA9 antibody (87143-2-RR, Clone: 252374E1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: Human lung cancer （Adenocarcinoma）, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87143-2-RR targets NDUFA9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16832

  Product name: Recombinant human NDUFA9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-273 aa of BC009311

  Sequence: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLL

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• Calculated Molecular Weight: 377 aa, 43 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009311
• Gene Symbol: NDUFA9
• Gene ID (NCBI): 4704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16795
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA9 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity.