NDUFB7 Monoclonal antibody, PBS Only

NDUFB7 Monoclonal Antibody for Indirect ELISA, IHC, WB
Cat No. 68362-1-PBS
Clone No.1H8C1

Host / Isotype

Mouse / IgG1

Reactivity

rabbit, pig, rat, mouse, human

Applications

Indirect ELISA, IHC, WB

Complex I B18, CI-B18, CI B18, Cell adhesion protein SQM1, B18

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68362-1-PBS targets NDUFB7 in Indirect ELISA, IHC, WB applications and shows reactivity with rabbit, pig, rat, mouse, human samples.

Tested Reactivity rabbit, pig, rat, mouse, human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6720

Product name: Recombinant human NDUFB7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-137 aa of BC002595

Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Calculated Molecular Weight 16 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002595
Gene Symbol NDUFB7
Gene ID (NCBI) 4713
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17568
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).

Loading...
||
New chat Able
正在加载,请稍候...