NDUFB7 Monoclonal antibody

NDUFB7 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 68362-1-Ig
Clone No.1H8C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, FC (Intra), ELISA

Complex I B18, CI-B18, CI B18, Cell adhesion protein SQM1, B18

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, PC-3 cell, pig heart tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68362-1-Ig targets NDUFB7 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6720

Product name: Recombinant human NDUFB7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-137 aa of BC002595

Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Calculated Molecular Weight 16 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002595
Gene Symbol NDUFB7
Gene ID (NCBI) 4713
RRIDAB_3085084
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17568
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).

Protocols

Product Specific Protocols
WB protocol for NDUFB7 antibody 68362-1-IgDownload protocol
IHC protocol for NDUFB7 antibody 68362-1-IgDownload protocol
FC protocol for NDUFB7 antibody 68362-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...