NDUFB8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDUFB8 Polyclonal antibody (14794-1-AP)

• Featured Product
• KD/KO Validated

NDUFB8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14794-1-AP

Publications(103)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ASHI, CI ASHI, CIASHI, CI-ASHI, Complex I-ASHI

• 

  WB analysis using 14794-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14794-1-AP (NDUFB8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of various samples using 14794-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with PK30006 (OXPHOS Cocktail (Human recommended)) at dilution of 1:4000 incubated at room temperature for 1 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14794-1-AP

  WB result of NDUFB8 antibody (14794-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDUFB8 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 14794-1-AP

  IP result of anti-NDUFB8 (IP:14794-1-AP, 4ug; Detection:14794-1-AP 1:2000) with HepG2 cells lysate 880 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 14794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14794-1-AP (NDUFB8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14794-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14794-1-AP (NDUFB8 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 14794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14794-1-AP (NDUFB8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14794-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14794-1-AP (NDUFB8 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14794-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14794-1-AP (NDUFB8 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14794-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFB8 antibody (14794-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14794-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFB8 antibody (14794-1-AP) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, A549 cells, various samples, 3T3-L1 cells, mouse brain tissue, mouse liver tissue, rat brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue, human heart tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14794-1-AP targets NDUFB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6495

  Product name: Recombinant human NDUFB8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC000466

  Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

• Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC000466
• Gene Symbol: NDUFB8
• Gene ID (NCBI): 4714
• RRID: AB_2150970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95169
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
canine	WB	Cell Metab; Formation of I2+III2 supercomplex rescues respiratory chain defects; Authors - Chao Liang
human	WB	Nat Immunol; Nucleophosmin 1 promotes mucosal immunity by supporting mitochondrial oxidative phosphorylation and ILC3 activity; Authors - Rongchuan Zhao
human	WB	Protein Cell; Isolation and Proteomics of Human Skeletal Muscle Lipid Droplets Identify Anchored Mitochondria and Associated TPD52L2; Authors - Xiaochuan Fu
mouse,human	WB	Nat Commun; Targeting tRNA-dependent tyrosine usage unveils a metabolic vulnerability in hepatocellular carcinoma.; Authors - Hongli Zhang
mouse	WB	Nat Commun; Defective vascular smooth muscle cell tafazzin impairs mitochondrial function and promotes atherosclerosis in preclinical models.; Authors - Cindy Dong
human	IHC	Nat Commun; CAV2-expressing nerves induce metabolic switch toward mitochondrial oxidative phosphorylation to promote cancer stemness.; Authors - Ze Zhang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Edward (Verified Customer) (11-15-2022)

Used with 12 ug protein lysate NDUFB8 works well, both with ECL detection and fluorescent secondary antibodies it gives a strong band

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: K562 and KCL22