NDUFS2 Recombinant monoclonal antibody, PBS Only (Detector)

NDUFS2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84880-1-PBS
Clone No.242238D4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

242238D4, CI 49kD, CI-49kD, Complex I 49kD, Complex I-49kD

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84880-1-PBS targets NDUFS2 as part of a matched antibody pair:

MP01653-2: 84880-3-PBS capture and 84880-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28008

Product name: Recombinant human NDUFS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-464 aa of BC000170

Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC000170
Gene Symbol NDUFS2
Gene ID (NCBI) 4720
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75306
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mitochondrial Complex I, responsible for the oxidation of NADH, is suspected to be an integral component of the O2-sensing pathway. NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2), a key subunit of complex I in the mitochondrial electron transport chain (ETC), is essential for acute oxygen-sensing and hypoxic pulmonary vasoconstriction (PMID: 30922174). Functions of NDUFS2 are associated with growth, cell-membrane integrity, ROS generation, apoptosis, necrosis, Complex I respiration, and synthesis of ATP (PMID: 33744462).

Loading...
||
New chat Able
正在加载,请稍候...