NDUFS2 Recombinant monoclonal antibody

NDUFS2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 84880-1-RR
Clone No.242238D4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

242238D4, CI 49kD, CI-49kD, Complex I 49kD, Complex I-49kD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, HeLa cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IHC detected inhuman stomach cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84880-1-RR targets NDUFS2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28008

Product name: Recombinant human NDUFS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-464 aa of BC000170

Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC000170
Gene Symbol NDUFS2
Gene ID (NCBI) 4720
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75306
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial Complex I, responsible for the oxidation of NADH, is suspected to be an integral component of the O2-sensing pathway. NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2), a key subunit of complex I in the mitochondrial electron transport chain (ETC), is essential for acute oxygen-sensing and hypoxic pulmonary vasoconstriction (PMID: 30922174). Functions of NDUFS2 are associated with growth, cell-membrane integrity, ROS generation, apoptosis, necrosis, Complex I respiration, and synthesis of ATP (PMID: 33744462).

Protocols

Product Specific Protocols
FC protocol for NDUFS2 antibody 84880-1-RRDownload protocol
IHC protocol for NDUFS2 antibody 84880-1-RRDownload protocol
WB protocol for NDUFS2 antibody 84880-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...