NDUFS3 Monoclonal antibody

• 

  WB analysis using 68066-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  WB analysis of HEK-293 using 68066-1-Ig

  WB result of NDUFS3 antibody (68066-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDUFS3 transfected HEK-293 cells.

• 

  WB analysis of pig brain using 68066-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit brain using 68066-1-Ig

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 68066-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 68066-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 68066-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68066-1-Ig (NDUFS3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 68066-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68066-1-Ig (NDUFS3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NDUFS3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68066-1-Ig

Clone No.1A1B3

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, ELISA

Synonyms

1A1B3, CI 30kD, CI30kD, CI-30kD, Complex I-30kD

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, mouse brain tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

68066-1-Ig targets NDUFS3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7072

  Product name: Recombinant human NDUFS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC000617

  Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000617
• Gene Symbol: NDUFS3
• Gene ID (NCBI): 4722
• RRID: AB_2918807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75489
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420). The full length has a transit peptide with 36 amino acids.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Sci China Life Sci; CRISPR screening identifies protein methylation and ubiquitination modifications that modulate aflatoxin B1 cytotoxicity; Authors - Huaqiang Yang
human	WB	Sci Rep; Characterization of a new mutation of mitochondrial ND6 gene in hepatocellular carcinoma and its effects on respiratory complex I; Authors - Veronica Bazzani