NDUFS3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68066-1-Ig (same clone as 68066-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68066-1-Ig (same clone as 68066-1-PBS)

  WB result of NDUFS3 antibody (68066-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDUFS3 transfected HEK-293 cells. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 68066-1-Ig (same clone as 68066-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit brain using 68066-1-Ig (same clone as 68066-1-PBS)

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 68066-1-Ig (same clone as 68066-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 68066-1-Ig (same clone as 68066-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 68066-1-Ig (NDUFS3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 68066-1-Ig (same clone as 68066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68066-1-Ig (NDUFS3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 68066-1-Ig (same clone as 68066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68066-1-Ig (NDUFS3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68066-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NDUFS3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68066-1-PBS

Clone No.1A1B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

1A1B3, CI 30kD, CI30kD, CI-30kD, Complex I-30kD

---

Product Information

68066-1-PBS targets NDUFS3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7072

  Product name: Recombinant human NDUFS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC000617

  Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000617
• Gene Symbol: NDUFS3
• Gene ID (NCBI): 4722
• RRID: AB_2918807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75489
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420). The full length has a transit peptide with 36 amino acids.