NDUFS5 Monoclonal antibody, PBS Only (Detector)

NDUFS5 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66053-1-PBS
Clone No.2C2A5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

2C2A5, CI 15 kDa, CI-15 kDa, Complex I 15 kDa, Complex I-15 kDa

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66053-1-PBS targets NDUFS5 as part of a matched antibody pair:

MP50607-1: 66053-2-PBS capture and 66053-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7663

Product name: Recombinant human NDUFS5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-106 aa of BC001884

Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC001884
Gene Symbol NDUFS5
Gene ID (NCBI) 4725
RRIDAB_11043342
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43920
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NDUFS5 gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. The NDUFS5 mRNA is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart (PMID: 10070614). The NDUFS5 (15 kDa) subunit located at mitochondrion and contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds (PMID: 21310150). Proteinteach's NDUFS5 antibody 66053-1-Ig is capable of detecting the 15 kDa protein in Western blotting.

Loading...
||
New chat

Able

正在加载,请稍候...