NDUFS6 Polyclonal antibody

NDUFS6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14417-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

CI 13kD A, CI-13kD-A, Complex I 13kD A, Complex I-13kD-A, NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human heart tissue, human liver tissue, rat liver tissue, mouse heart tissue, mouse liver tissue, mouse brain tissue, rat brain tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 9 publications below

Product Information

14417-1-AP targets NDUFS6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5762

Product name: Recombinant human NDUFS6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-124 aa of BC046155

Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC046155
Gene Symbol NDUFS6
Gene ID (NCBI) 4726
RRIDAB_2149024
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75380
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as 1CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.

Protocols

Product Specific Protocols
IF protocol for NDUFS6 antibody 14417-1-APDownload protocol
IHC protocol for NDUFS6 antibody 14417-1-APDownload protocol
IP protocol for NDUFS6 antibody 14417-1-APDownload protocol
WB protocol for NDUFS6 antibody 14417-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Res

NDUFAB1 confers cardio-protection by enhancing mitochondrial bioenergetics through coordination of respiratory complex and supercomplex assembly.

Authors - Tingting Hou
human

Genes Dev

ALS/FTD-associated protein FUS induces mitochondrial dysfunction by preferentially sequestering respiratory chain complex mRNAs.

Authors - Yueh-Lin Tsai
mouseWB

Theranostics

Proteomic analysis reveals ginsenoside Rb1 attenuates myocardial ischemia/reperfusion injury through inhibiting ROS production from mitochondrial complex I.

Authors - Lujing Jiang
humanWB

Cancer Lett

PMID: 29906487

Authors - Linhua Lan
mouseWB

FASEB J

PMID: 31530015

Authors - Rufeng Zhang
mouseWB

Front Aging Neurosci

Hippocampus-Based Mitochondrial Respiratory Function Decline Is Responsible for Perioperative Neurocognitive Disorders.

Authors - Keqiang He
Loading...
||
New chat Able
正在加载,请稍候...