NDUFS6 Polyclonal antibody

• 

  WB analysis using 14417-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14417-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 14417-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14417-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14417-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 14417-1-AP

  IP result of anti-NDUFS6 (IP:14417-1-AP, 4ug; Detection:14417-1-AP 1:300) with mouse liver tissue lysate 3200 ug.

• 

  IHC staining of mouse brain using 14417-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14417-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14417-1-AP (NDUFS6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 14417-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS6 antibody (14417-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 14417-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NDUFS6 antibody (14417-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

NDUFS6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14417-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CI 13kD A, CI-13kD-A, Complex I 13kD A, Complex I-13kD-A, NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, human heart tissue, human liver tissue, rat liver tissue, mouse heart tissue, mouse liver tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below

Product Information

14417-1-AP targets NDUFS6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5762

  Product name: Recombinant human NDUFS6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC046155

  Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC046155
• Gene Symbol: NDUFS6
• Gene ID (NCBI): 4726
• RRID: AB_2149024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75380
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as 1CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Res; NDUFAB1 confers cardio-protection by enhancing mitochondrial bioenergetics through coordination of respiratory complex and supercomplex assembly.; Authors - Tingting Hou
human		Genes Dev; ALS/FTD-associated protein FUS induces mitochondrial dysfunction by preferentially sequestering respiratory chain complex mRNAs.; Authors - Yueh-Lin Tsai
mouse	WB	Theranostics; Proteomic analysis reveals ginsenoside Rb1 attenuates myocardial ischemia/reperfusion injury through inhibiting ROS production from mitochondrial complex I.; Authors - Lujing Jiang
human	WB	Cancer Lett; PMID: 29906487; Authors - Linhua Lan
mouse	WB	FASEB J; PMID: 31530015; Authors - Rufeng Zhang
mouse	WB	Front Aging Neurosci; Hippocampus-Based Mitochondrial Respiratory Function Decline Is Responsible for Perioperative Neurocognitive Disorders.; Authors - Keqiang He