NECAB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NECAB1 Polyclonal antibody, PBS Only (16477-1-PBS)

• 

  IHC staining of mouse brain using 16477-1-AP (same clone as 16477-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16477-1-AP (NECAB1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16477-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16477-1-AP (same clone as 16477-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16477-1-AP (NECAB1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16477-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 16477-1-AP (same clone as 16477-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using NECAB1 antibody (16477-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16477-1-PBS in a different storage buffer formulation.

NECAB1 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 16477-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

16477-1-PBS targets NECAB1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9591

  Product name: Recombinant human NECAB1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 252-351 aa of BC016340

  Sequence: MLVQRQMSVMEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN

• Full Name: N-terminal EF-hand calcium binding protein 1
• Calculated Molecular Weight: 351 aa, 40 kDa
• GenBank Accession Number: BC016340
• Gene Symbol: NECAB1
• Gene ID (NCBI): 64168
• RRID: AB_3085492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N987
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NECAB1, also named as EFCBP1, is a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains Short Communication.