NEDD4L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NEDD4L Polyclonal antibody, PBS Only (13690-1-PBS)

• 

  WB analysis using 13690-1-AP (same clone as 13690-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13690-1-AP (NEDD4L antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 13690-1-AP (same clone as 13690-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 13690-1-AP (NEDD4L antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 13690-1-AP (same clone as 13690-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 13690-1-AP (NEDD4L antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13690-1-AP (same clone as 13690-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13690-1-AP (NEDD4L antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IP experiment of C6 using 13690-1-AP (same clone as 13690-1-PBS)

  IP result of anti-NEDD4L (IP:13690-1-AP, 4ug; Detection:13690-1-AP 1:300) with C6 cells lysate 1000 ug. This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13690-1-AP (NEDD4L antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13690-1-AP (NEDD4L Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13690-1-AP (NEDD4L Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 13690-1-AP (NEDD4L antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 13690-1-AP (NEDD4L antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13690-1-AP (NEDD4L Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13690-1-AP (same clone as 13690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13690-1-AP (NEDD4L Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 13690-1-AP (same clone as 13690-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-3 cells using NEDD4L antibody (13690-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13690-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NEDD4L Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13690-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase NEDD4-like, EC:2.3.2.26, HECT-type E3 ubiquitin transferase NED4L, hNEDD4-2, KIAA0439

---

Product Information

13690-1-PBS targets NEDD4L in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4565

  Product name: Recombinant human NEDD4L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 565-911 aa of BC032597

  Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

• Full Name: neural precursor cell expressed, developmentally down-regulated 4-like
• Calculated Molecular Weight: 854 aa, 96 kDa
• Observed Molecular Weight: 112 kDa, 125 kDa
• GenBank Accession Number: BC032597
• Gene Symbol: NEDD4L
• Gene ID (NCBI): 23327
• RRID: AB_2149326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen.