NEK1 Polyclonal antibody

• 

  WB analysis of HeLa using 27146-1-AP

  WB result of NEK1 antibody (27146-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NEK1 transfected HeLa cells.

• 

  WB analysis of PC-12 using 27146-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 27146-1-AP (NEK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 27146-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 27146-1-AP (NEK1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of PC-12 using 27146-1-AP

  IP result of anti-NEK1 (IP:27146-1-AP, 4ug; Detection:27146-1-AP 1:500) with PC-12 cells lysate 3080 ug.

• 

  IP experiment of HeLa using 27146-1-AP

  HeLa lysates prepared and IP of NEK1 performed using 1.0 μg of 27146-1-AP coupled to protein A- Sepharose beads. The Ponceau stained transfers of each blot are shown. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IHC staining of human lung cancer using 27146-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27146-1-AP (NEK1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27146-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27146-1-AP (NEK1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 27146-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NEK1 antibody (27146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

NEK1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 27146-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.7.11.1, KIAA1901, Never in mitosis A-related kinase 1, NimA related protein kinase 1, NimA-related protein kinase 1

---

Tested Applications

• Positive WB detected in: PC-12 cells, mouse pancreas tissue, HeLa cells
• Positive IP detected in: PC-12 cells, HeLa cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

27146-1-AP targets NEK1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25970

  Product name: Recombinant human NEK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 557-740 aa of BC114491

  Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD

• Full Name: NIMA (never in mitosis gene a)-related kinase 1
• Calculated Molecular Weight: 1258 aa, 143 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC114491
• Gene Symbol: NEK1
• Gene ID (NCBI): 4750
• RRID: AB_2880773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PY6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Life Sci Alliance; Functional characterization of C21ORF2 association with the NEK1 kinase mutated in human in diseases; Authors - Mateusz Gregorczyk
human	WB,IHC	Cancers (Basel); Differential Expression of NEK Kinase Family Members in Esophageal Adenocarcinoma and Barrett's Esophagus; Authors - Lei Chen
human	WB	Adv Sci (Weinh); HDAC8 Enhances the Function of HIF-2α by Deacetylating ETS1 to Decrease the Sensitivity of TKIs in ccRCC; Authors - Kang Qian ; KD Validated