Use Able AI chat for product recommendations

NEK1 Recombinant monoclonal antibody, PBS Only (Capture)

NEK1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86224-2-PBS
Clone No.250128H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

EC:2.7.11.1, KIAA1901, Never in mitosis A-related kinase 1, NimA related protein kinase 1, NimA-related protein kinase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86224-2-PBS targets NEK1 as part of a matched antibody pair:

MP02331-1: 86224-2-PBS capture and 86224-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25970

Product name: Recombinant human NEK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 557-740 aa of BC114491

Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD

Predict reactive species
Full Name NIMA (never in mitosis gene a)-related kinase 1
Calculated Molecular Weight 1258 aa, 143 kDa
Observed Molecular Weight 170-180 kDa
GenBank Accession NumberBC114491
Gene Symbol NEK1
Gene ID (NCBI) 4750
RRIDAB_3744726
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96PY6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NEK1 (NIMA-Related Kinase 1) is a serine/threonine-protein kinase that plays a multifaceted and critical role in cellular homeostasis. It is widely expressed and involved in key biological processes, most notably the DNA Damage Response (DDR) and cilium assembly and function. NEK1 kinase activity is regulated in response to genotoxic stress, where it facilitates the repair of double-strand breaks alongside proteins like ATM and ATR. Simultaneously, it localizes to the basal body of the primary cilium, governing ciliary structure and trafficking. The paramount importance of NEK1 is highlighted by its strong genetic association with Amyotrophic Lateral Sclerosis (ALS); loss-of-function mutations in NEK1 are recognized as one of the most common genetic causes of familial and sporadic ALS. Furthermore, biallelic mutations in NEK1 are responsible for the severe ciliopathy known as short-rib thoracic dysplasia, underscoring its vital role in skeletal development. Thus, NEK1 represents a crucial molecule at the crossroads of genome integrity, ciliary function, and human neurodegenerative and developmental diseases.

Loading...
||
New chat

Able

正在加载,请稍候...