Use Able AI chat for product recommendations

NEK1 Recombinant monoclonal antibody

NEK1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86224-2-RR
Clone No.250128H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

EC:2.7.11.1, KIAA1901, Never in mitosis A-related kinase 1, NimA related protein kinase 1, NimA-related protein kinase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse testis tissue, HEK-293T cells, K-562 cells, PC-12 cells, rat testis tissue
Positive IF/ICC detected inStarvation treated hTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86224-2-RR targets NEK1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25970

Product name: Recombinant human NEK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 557-740 aa of BC114491

Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD

Predict reactive species
Full Name NIMA (never in mitosis gene a)-related kinase 1
Calculated Molecular Weight 1258 aa, 143 kDa
Observed Molecular Weight 170-180 kDa
GenBank Accession NumberBC114491
Gene Symbol NEK1
Gene ID (NCBI) 4750
RRIDAB_3744726
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96PY6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEK1 (NIMA-Related Kinase 1) is a serine/threonine-protein kinase that plays a multifaceted and critical role in cellular homeostasis. It is widely expressed and involved in key biological processes, most notably the DNA Damage Response (DDR) and cilium assembly and function. NEK1 kinase activity is regulated in response to genotoxic stress, where it facilitates the repair of double-strand breaks alongside proteins like ATM and ATR. Simultaneously, it localizes to the basal body of the primary cilium, governing ciliary structure and trafficking. The paramount importance of NEK1 is highlighted by its strong genetic association with Amyotrophic Lateral Sclerosis (ALS); loss-of-function mutations in NEK1 are recognized as one of the most common genetic causes of familial and sporadic ALS. Furthermore, biallelic mutations in NEK1 are responsible for the severe ciliopathy known as short-rib thoracic dysplasia, underscoring its vital role in skeletal development. Thus, NEK1 represents a crucial molecule at the crossroads of genome integrity, ciliary function, and human neurodegenerative and developmental diseases.

Protocols

Product Specific Protocols
IF protocol for NEK1 antibody 86224-2-RRDownload protocol
WB protocol for NEK1 antibody 86224-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...