NEU1 Polyclonal antibody

• 

  WB analysis using 28167-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28167-1-AP (NEU1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 28167-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28167-1-AP (NEU1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 28167-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28167-1-AP (NEU1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NEU1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28167-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Acetylneuraminyl hydrolase, EC:3.2.1.18, G9 sialidase, Lysosomal sialidase, N acetyl alpha neuraminidase 1

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HepG2 cells, L02 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28167-1-AP targets NEU1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27945

  Product name: Recombinant human NEU1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-415 aa of BC011900

  Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

• Full Name: sialidase 1 (lysosomal sialidase)
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC011900
• Gene Symbol: NEU1
• Gene ID (NCBI): 4758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99519
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal sialic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflammation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Additionally, it is reported that mutations in human NEU1 could lead to sialidosis (PMID:14517945).