NEU2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NEU2 Polyclonal antibody, PBS Only (24523-1-PBS)

• 

  WB analysis using 24523-1-AP (same clone as 24523-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 24523-1-AP (NEU2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24523-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 24523-1-AP (same clone as 24523-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 24523-1-AP (NEU2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24523-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 24523-1-AP (same clone as 24523-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24523-1-AP (NEU2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24523-1-PBS in a different storage buffer formulation.

NEU2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24523-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Sialidase 2, SIAL2, N-acetyl-alpha-neuraminidase 2, N acetyl alpha neuraminidase 2, EC:3.2.1.18

---

Product Information

24523-1-PBS targets NEU2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17386

  Product name: Recombinant human NEU2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 66-380 aa of BC107053

  Sequence: VQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

• Full Name: sialidase 2 (cytosolic sialidase)
• Calculated Molecular Weight: 380 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC107053
• Gene Symbol: NEU2
• Gene ID (NCBI): 4759
• RRID: AB_2879588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3R4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.