CoraLite® Plus 488-conjugated NEU2 Recombinant monoclonal antibody

NEU2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83934-2
Clone No.240685C12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC

240685C12, Cytosolic sialidase, EC:3.2.1.18, N acetyl alpha neuraminidase 2, N-acetyl-alpha-neuraminidase 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83934-2 targets NEU2 in IF/ICC applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17386

Product name: Recombinant human NEU2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 66-380 aa of BC107053

Sequence: VQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

Predict reactive species
Full Name sialidase 2 (cytosolic sialidase)
Calculated Molecular Weight 380 aa, 42 kDa
GenBank Accession NumberBC107053
Gene Symbol NEU2
Gene ID (NCBI) 4759
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y3R4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NEU2, also named as Sialidase 2, neuraminidase 2, catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosaccharides. NEU2 is localized in the cytosol and plasma membrane and takes part in myoblast and neuronal differentiation. It is almost undetectable under normal physiological conditions, and was found to be involved into apoptotic events in pancreatic ductal adenocarcinoma, one of the most dangerous cancers due to poor diagnosis and prognosis. (PMID: 30439363)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NEU2 antibody CL488-83934-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...