NFATC2 Monoclonal antibody

NFATC2 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66917-1-Ig
Clone No.1F3B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

NFAT1, NFATP, NFAT pre-existing subunit, NFAT pre existing subunit, NF ATp

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRamos cells, Daudi cells, Jurkat cells
Positive IHC detected inhuman breast cancer tissue, human lymphoma tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66917-1-Ig targets NFATC2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17990

Product name: Recombinant human NFATC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC136418

Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV

Predict reactive species
Full Name nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Calculated Molecular Weight 925 aa, 100 kDa
Observed Molecular Weight 135-140 kDa
GenBank Accession NumberBC136418
Gene Symbol NFATC2
Gene ID (NCBI) 4773
RRIDAB_2882244
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13469
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa.

Protocols

Product Specific Protocols
WB protocol for NFATC2 antibody 66917-1-IgDownload protocol
IHC protocol for NFATC2 antibody 66917-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...