NFU1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NFU1 Polyclonal antibody, PBS Only (25598-1-PBS)

• 

  WB analysis of mouse cerebellum using 25598-1-AP (same clone as 25598-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 25598-1-AP (same clone as 25598-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 25598-1-AP (same clone as 25598-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 25598-1-AP (same clone as 25598-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 25598-1-AP (same clone as 25598-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 25598-1-AP (same clone as 25598-1-PBS)

  IP result of anti-NFU1 (IP:25598-1-AP, 4ug; Detection:25598-1-AP 1:1000) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25598-1-AP (same clone as 25598-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 25598-1-AP (NFU1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25598-1-PBS in a different storage buffer formulation.

NFU1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 25598-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

25598-1-PBS targets NFU1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22343

  Product name: Recombinant human NFU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-254 aa of BC113692

  Sequence: MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP

• Full Name: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae)
• Calculated Molecular Weight: 254 aa, 28 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC113692
• Gene Symbol: NFU1
• Gene ID (NCBI): 27247
• RRID: AB_2880151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMS0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NFU1, also named as HIRA-interacting protein 5 or CGI-33, is a 254 amino acid protein, which belongs to the NifU family. NFU1 localizes in the Mitochondrion. NFU1 is widely expressed in adult tissues. NFU1, as an Iron-sulfur cluster scaffold protein, which can assemble clusters and deliver them to target proteins. It has an association with Multiple mitochondrial dysfunctions syndrome 1.