XLF Monoclonal antibody

• 

  WB analysis using 66552-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66552-1-Ig (XLF antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 66552-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66552-1-Ig (XLF antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 66552-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66552-1-Ig (XLF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66552-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66552-1-Ig (NHEJ1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66552-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66552-1-Ig (NHEJ1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

XLF Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66552-1-Ig

Clone No.1F8C7

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

NHEJ1, Protein cernunnos, XLF, XRCC4 like factor

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells
• Positive IHC detected in: human testis tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-30000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66552-1-Ig targets XLF in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2496

  Product name: Recombinant human NHEJ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-299 aa of BC030986

  Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS

• Full Name: nonhomologous end-joining factor 1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC030986
• Gene Symbol: XLF
• Gene ID (NCBI): 79840
• RRID: AB_2881914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H9Q4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XRCC4-like factor (XLF), also known as Cernunnos and NHEJ1, is a protein encoded by the human NHEJ1 gene and an important repair factor for DNA double-strand breaks. NHEJ is a well-known mechanism for the repair of double-strand breaks (DSBs), a lethal type of DNA damage in mammalian cells. It basically utilizes a group of enzymes to take hold of the ends of a broken DNA molecule, create a bridge between them, and subsequently re-ligate the broken DNA molecule.