CoraLite® Plus 750-conjugated XLF Monoclonal antibody

• 

  WB analysis using CL750-66552

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-66552 (XLF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

XLF Monoclonal Antibody for WB

Cat No. CL750-66552

Clone No.1F8C7

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB

Synonyms

FLJ12610, NHEJ1, Protein cernunnos, XLF, XRCC4 like factor

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-66552 targets XLF in WB applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2496

  Product name: Recombinant human NHEJ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-299 aa of BC030986

  Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS

• Full Name: nonhomologous end-joining factor 1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC030986
• Gene Symbol: XLF
• Gene ID (NCBI): 79840
• RRID: AB_3084894
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H9Q4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

XRCC4-like factor (XLF), also known as Cernunnos and NHEJ1, is a protein encoded by the human NHEJ1 gene and an important repair factor for DNA double-strand breaks. NHEJ is a well-known mechanism for the repair of double-strand breaks (DSBs), a lethal type of DNA damage in mammalian cells. It basically utilizes a group of enzymes to take hold of the ends of a broken DNA molecule, create a bridge between them, and subsequently re-ligate the broken DNA molecule.