NHLRC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NHLRC2 Polyclonal antibody, PBS Only (29416-1-PBS)

• 

  WB analysis using 29416-1-AP (same clone as 29416-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29416-1-AP (NHLRC2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29416-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29416-1-AP (same clone as 29416-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29416-1-AP (NHLRC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29416-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29416-1-AP (same clone as 29416-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29416-1-AP (NHLRC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29416-1-PBS in a different storage buffer formulation.

NHLRC2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29416-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29416-1-PBS targets NHLRC2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30159

  Product name: Recombinant human NHLRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-200 aa of NM_198514

  Sequence: QKVDGWEQDLSVPEFPEGLEWLNTEEPISVYKDLCGKIVVLDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKD

• Full Name: NHL repeat containing 2
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_198514
• Gene Symbol: NHLRC2
• Gene ID (NCBI): 374354
• RRID: AB_2918302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBF2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.