NHP2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NHP2 Recombinant monoclonal antibody, PBS Only (86677-1-PBS)

• 

  WB analysis using 86677-1-RR (same clone as 86677-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 86677-1-RR (NHP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86677-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86677-1-RR (same clone as 86677-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NHP2 antibody (86677-1-RR, Clone: 251700B11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86677-1-PBS in a different storage buffer formulation.

NHP2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86677-1-PBS

Clone No.251700B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HSPC286, NHP 2, NHP2P, NOLA2

---

Product Information

86677-1-PBS targets NHP2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7251

  Product name: Recombinant human NHP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC000009

  Sequence: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

• Full Name: NHP2 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17-22 kDa
• GenBank Accession Number: BC000009
• Gene Symbol: NHP2
• Gene ID (NCBI): 55651
• RRID: AB_3745048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NX24
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NHP2 belongs to the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. It is required for ribosome biogenesis and telomere maintenance, and for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.