Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, mouse pancreas tissue, HepG2 cells, Jurkat cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue, MCF-7 cells |
| Positive IHC detected in | human cervical cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15802-1-AP targets NHP2L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8532 Product name: Recombinant human NHP2L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC005358 Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV Predict reactive species |
| Full Name | NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) |
| Calculated Molecular Weight | 128 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005358 |
| Gene Symbol | NHP2L1 |
| Gene ID (NCBI) | 4809 |
| RRID | AB_2251452 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55769 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NHP2L1, belongs to the ribosomal protein L7Ae family, is a component of the spliceosome complex. It is recruited to introns following the attachment of U4 and U6 RNAs, and is required for subsequent recruitment of PRP31 and activation of the spliceosomal complex [PMID: 17412961]. It binds to the 5'-stem-loop of U4 snRNA and may have a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding [PMID: 10545122].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NHP2L1 antibody 15802-1-AP | Download protocol |
| IHC protocol for NHP2L1 antibody 15802-1-AP | Download protocol |
| WB protocol for NHP2L1 antibody 15802-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NHP2L1 Polyclonal antibody (Cat# 15802-1-AP) has 6 citations published in Molecular Cell, Nucleic Acids Research, Gastro Hep Adv, and Biochim Biophys Acta Proteins Proteom. Research fields span nucleolar phase separation and chromatin organization, U6 snRNA modification and splicing fidelity, pre-rRNA processing, SMN complex assembly, pancreatic acinar metaplasia with ER stress adaptation, and cardiac endothelial phosphoproteomic responses to ischemia. Applications cited include WB, IF, and IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Mol Cell LARP7-Mediated U6 snRNA Modification Ensures Splicing Fidelity and Spermatogenesis in Mice. | ||
Mol Cell Condensates induced by transcription inhibition localize active chromatin to nucleoli. | ||
Mol Cell Nascent Pre-rRNA Sorting via Phase Separation Drives the Assembly of Dense Fibrillar Components in the Human Nucleolus.
| ||
Nucleic Acids Res NUFIP and the HSP90/R2TP chaperone bind the SMN complex and facilitate assembly of U4-specific proteins. | ||
Gastro Hep Adv Increased Protein Synthesis With Reduced Endoplasmic Reticulum Stress Defines a Specific Adaptation in Pancreatic Acinar Metaplasia. | ||
Biochim Biophys Acta Proteins Proteom Phosphoproteomic response of cardiac endothelial cells to ischemia and ultrasound. |
