NHS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NHS Polyclonal antibody, PBS Only (31487-1-PBS)

• 

  IHC staining of human liver using 31487-1-AP (same clone as 31487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 31487-1-AP (NHS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 31487-1-AP (same clone as 31487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 31487-1-AP (NHS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31487-1-PBS in a different storage buffer formulation.

NHS Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 31487-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

SCML1

---

Product Information

31487-1-PBS targets NHS in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34757

  Product name: Recombinant human NHS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1532-1651 aa of BC136415

  Sequence: YRMSATEILKSPILPKPPGELTAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSST

• Full Name: Nance-Horan syndrome (congenital cataracts and dental anomalies)
• GenBank Accession Number: BC136415
• Gene Symbol: NHS
• Gene ID (NCBI): 4810
• RRID: AB_3742435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6T4R5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NHS (Nance-Horan syndrome protein), also named Actin remodeling regulator NHS, may function in cell morphology by maintaining the integrity of the circumferential actin ring and controlling lamellipod formation. Involved in the regulation eye, tooth, brain, and craniofacial development (PMID: 20332100).