NICN1 Monoclonal antibody

• 

  WB analysis of U-251 using 67328-1-Ig

  U-251 cells were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 67328-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 67328-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

NICN1 Monoclonal Antibody for WB, ELISA

Cat No. 67328-1-Ig

Clone No.5B7G6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

NICN1, nicolin 1, PGs5

---

Tested Applications

• Positive WB detected in: U-251 cells, NCCIT cells, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67328-1-Ig targets NICN1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6581

  Product name: Recombinant human NICN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-213 aa of BC050653

  Sequence: MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT

• Full Name: nicolin 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC050653
• Gene Symbol: NICN1
• Gene ID (NCBI): 84276
• RRID: AB_2882587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSH3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.