NICN1 Monoclonal antibody, PBS Only

• 

  WB analysis of U-251 using 67328-1-Ig (same clone as 67328-1-PBS)

  U-251 cells were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 67328-1-Ig (same clone as 67328-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 67328-1-Ig (same clone as 67328-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67328-1-Ig (NICN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67328-1-PBS in a different storage buffer formulation.

NICN1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67328-1-PBS

Clone No.5B7G6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

NICN1, nicolin 1, PGs5

---

Product Information

67328-1-PBS targets NICN1 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6581

  Product name: Recombinant human NICN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-213 aa of BC050653

  Sequence: MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT

• Full Name: nicolin 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC050653
• Gene Symbol: NICN1
• Gene ID (NCBI): 84276
• RRID: AB_2882587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.