Use Able AI chat for product recommendations

CoraLite® Plus 647 Anti-Mouse NK1.1 (CD161) Rabbit Recombinant Antibody

NK1.1 (CD161) Uni-rAb® Recombinant Antibody for FC

Cat No. CL647-98820
Clone No.253074D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Klrb1c, CD161c, Ly55c, Nk 1, Nk 1.2

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98820 targets NK1.1 (CD161) in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg6938

Product name: Recombinant mouse KLRBC protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 67-223 aa of NM_001159904

Sequence: QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS

Predict reactive species
Full Name killer cell lectin-like receptor subfamily B member 1C
Calculated Molecular Weight25KD
GenBank Accession NumberNM_001159904
Gene Symbol Klrb1c
Gene ID (NCBI) 17059
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP27814
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

NK1.1 (CD161), also known as KLRB1 or NKR-P1A, is a type II transmembrane C-type lectin-like receptor and is expressed on the cell membrane as disulfide-linked homodimer (PMID: 8077657). It is expressed by the majority of NK cells and subsets of peripheral T cells, including both CD4+ and CD8+ T cells, and is expressed preferentially on adult T cells with a "memory" antigenic phenotype (PMID: 8077657; 22566826). Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion (PMID: 29686665).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 NK1.1 (CD161) antibody CL647-98820Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...