Product Information
26993-1-PBS targets NKAPL in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25779 Product name: Recombinant human NKAPL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-275 aa of BC101685 Sequence: YSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTM Predict reactive species |
| Full Name | NFKB activating protein-like |
| Observed Molecular Weight | 52 kDa, 65 kDa |
| GenBank Accession Number | BC101685 |
| Gene Symbol | NKAPL |
| Gene ID (NCBI) | 222698 |
| RRID | AB_3742208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5M9Q1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NKAPL (NF-kappa-B activating protein-like), also known as C6orf194, is a nuclear protein-coding gene located on chromosome 6p22.1. Initially identified as a germ cell-specific suppressor of Notch signaling essential for spermatogenesis, NKAPL has recently emerged as a tumor suppressor in non-small cell lung cancer through TRIM21 stabilization and NF-κB pathway inhibition. Additionally, NKAPL promoter methylation serves as a prognostic biomarker in multiple malignancies.(PMID: 25875095; 40605974)



