Product Information
33052-1-PBS targets NKX2-4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37291 Product name: Recombinant human NKX2-4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 288-354 aa of NM_033176 Sequence: QNGASTPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLYGRTW Predict reactive species |
| Full Name | NK2 homeobox 4 |
| Calculated Molecular Weight | 36kDa |
| Observed Molecular Weight | 38-41 kDa |
| GenBank Accession Number | NM_033176 |
| Gene Symbol | NKX2-4 |
| Gene ID (NCBI) | 644524 |
| RRID | AB_3742839 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9H2Z4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The NKX2-4 protein (full name: NK2 homeobox 4) belongs to the NK-2 type homeobox transcription factor family. Its main function is to act as a potential transcription factor, binding specifically to DNA sequences via its homeodomain and participating in the regulation of cell differentiation and the development of multicellular organisms. Studies have shown that this protein is active in the nucleus, and its aberrant expression may contribute to the development of acute myeloid leukemia by interfering with the normal differentiation of megakaryocytes and erythrocytes. Additionally, it can regulate the expression of genes such as TERT through allele-specific binding, thereby influencing tumor susceptibility in melanoma.
