NLGN4X Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NLGN4X Polyclonal antibody, PBS Only (27278-1-PBS)

• 

  WB analysis using 27278-1-AP (same clone as 27278-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27278-1-AP (NLGN4X antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27278-1-AP (same clone as 27278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27278-1-AP (NLGN4X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27278-1-AP (same clone as 27278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27278-1-AP (NLGN4X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27278-1-PBS in a different storage buffer formulation.

NLGN4X Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27278-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

ASPGX2, AUTSX2, HLNX, HNLX, neuroligin 4, X linked

---

Product Information

27278-1-PBS targets NLGN4X in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2426

  Product name: Recombinant human NLGN4X protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 469-816 aa of BC034018

  Sequence: FYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV

• Full Name: neuroligin 4, X-linked
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC034018
• Gene Symbol: NLGN4X
• Gene ID (NCBI): 57502
• RRID: AB_3085943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0W4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NLGN4X is a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. NLGN4X has two isoforms with predicted MW's of 92 kDa and 94 kDa.