Product Information
13489-1-PBS targets NLGN4Y in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4311 Product name: Recombinant human NLGN4Y protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC032567 Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEAR Predict reactive species |
| Full Name | neuroligin 4, Y-linked |
| Calculated Molecular Weight | 816 aa, 92 kDa |
| Observed Molecular Weight | 92 kDa |
| GenBank Accession Number | BC032567 |
| Gene Symbol | NLGN4Y |
| Gene ID (NCBI) | 22829 |
| RRID | AB_2235981 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NFZ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NLGN4Y, one member of Neuroligins, is cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses , NLGN4Y was expressed in fetal and adult brain, prostate, testis, pancreas. NLGN4Y is homologous with its X-linked homolog, NLGN4X. The antibody can recognize both of NLGN4Y and NLGN4X at 72kDa mature form.
