NLRC5 Recombinant monoclonal antibody, PBS Only (Capture)

NLRC5 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83384-2-PBS
Clone No.240338D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240338D8, Caterpiller protein 16.1, CLR16.1, NOD27, NOD4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83384-2-PBS targets NLRC5 as part of a matched antibody pair:

MP00402-3: 83384-2-PBS capture and 83384-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34508

Product name: Recombinant human NLRC5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-160 aa of BC063566

Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR

Predict reactive species
Full Name NLR family, CARD domain containing 5
Calculated Molecular Weight204 kDa
GenBank Accession NumberBC063566
Gene Symbol NLRC5
Gene ID (NCBI) 84166
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86WI3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways.

Loading...
||
New chat Able
正在加载,请稍候...