NLRP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NLRP2 Polyclonal antibody, PBS Only (15182-1-PBS)

• 

  WB analysis of A549 using 15182-1-AP (same clone as 15182-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15182-1-AP (same clone as 15182-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human lung using 15182-1-AP (same clone as 15182-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 15182-1-AP (same clone as 15182-1-PBS)

  IP result of anti-NLRP2 (IP:15182-1-AP, 4ug; Detection:15182-1-AP 1:3000) with A549 cells lysate 920 ug. This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 15182-1-AP (same clone as 15182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15182-1-AP (NLRP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 15182-1-AP (same clone as 15182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15182-1-AP (NLRP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15182-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NLRP2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15182-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CLR19.9, NACHT, LRR and PYD domains-containing protein 2, NALP2, NBS1, Nucleotide-binding site protein 1

---

Product Information

15182-1-PBS targets NLRP2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7167

  Product name: Recombinant human NLRP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC001039

  Sequence: MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE

• Full Name: NLR family, pyrin domain containing 2
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 105-110 kDa
• GenBank Accession Number: BC001039
• Gene Symbol: NLRP2
• Gene ID (NCBI): 55655
• RRID: AB_2298531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX02
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.