NLRP3 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NLRP3 Recombinant monoclonal antibody, PBS Only (82453-2-PBS)

NLRP3 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82453-2-PBS

Clone No.251687B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein, EC:3.6.4.-

• 

  WB analysis of RAW 264.7 using 82453-2-RR (same clone as 82453-2-PBS)

  LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82453-2-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 82453-2-RR (same clone as 82453-2-PBS)

  LPS treated THP-1 cells were subjected to SDS PAGE followed by western blot with 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82453-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 82453-2-RR (same clone as 82453-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82453-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 82453-2-RR (same clone as 82453-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82453-2-PBS in a different storage buffer formulation.

---

Product Information

82453-2-PBS targets NLRP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26289

  Product name: Recombinant human NLRP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 937-1036 aa of NM_001079821

  Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

• Full Name: NLR family, pyrin domain containing 3
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_001079821
• Gene Symbol: NLRP3
• Gene ID (NCBI): 114548
• RRID: AB_3743405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96P20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa.