NLRP3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NLRP3 Recombinant monoclonal antibody (82453-2-RR)

NLRP3 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 82453-2-RR

Clone No.251687B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein, EC:3.6.4.-

• 

  WB analysis of RAW 264.7 using 82453-2-RR

  LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 82453-2-RR

  LPS treated THP-1 cells were subjected to SDS PAGE followed by western blot with 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 82453-2-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 82453-2-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 82453-2-RR (NLRP3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

---

Tested Applications

• Positive WB detected in: LPS treated RAW 264.7 cells, LPS treated THP-1 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82453-2-RR targets NLRP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26289

  Product name: Recombinant human NLRP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 937-1036 aa of NM_001079821

  Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

• Full Name: NLR family, pyrin domain containing 3
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_001079821
• Gene Symbol: NLRP3
• Gene ID (NCBI): 114548
• RRID: AB_3743405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96P20
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa.