NLRP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NLRP4 Polyclonal antibody, PBS Only (32694-1-PBS)

• 

  WB analysis using 32694-1-AP (same clone as 32694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32694-1-AP (NLRP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 32694-1-AP (same clone as 32694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32694-1-AP (NLRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 32694-1-AP (same clone as 32694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32694-1-AP (NLRP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32694-1-PBS in a different storage buffer formulation.

NLRP4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

NALP4, PAN2, PYPAF4, RNH2

---

Product Information

32694-1-PBS targets NLRP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38545

  Product name: Recombinant human NLRP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-200 aa of NM_134444.4

  Sequence: LMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIHLYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRDRFLYTFYFCCRELRELPPTS

• Full Name: NLR family, pyrin domain containing 4
• Calculated Molecular Weight: 113kDa，994aa
• Observed Molecular Weight: 98-105 kDa
• GenBank Accession Number: NM_134444.4
• Gene Symbol: NLRP4
• Gene ID (NCBI): 147945
• RRID: AB_3742711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96MN2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NLRP4 is a member of the NOD-like receptor (NLR) family, a group of intracellular pattern recognition receptors (PRRs) that play crucial roles in innate immunity, inflammation, and cell death regulation.