NLRP7 Recombinant monoclonal antibody, PBS Only

NLRP7 Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA
Cat No. 83996-4-PBS
Clone No.241120A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

NOD12, NALP7, NACHT, LRR and PYD domains-containing protein 7, HYDM, CLR19.4

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83996-4-PBS targets NLRP7 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27465

Product name: Recombinant human NLRP7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC109125

Sequence: MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTP

Predict reactive species
Full Name NLR family, pyrin domain containing 7
Calculated Molecular Weight112 kDa, 115 kDa, 118 kDa
GenBank Accession NumberBC109125
Gene Symbol NLRP7
Gene ID (NCBI) 199713
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ8WX94
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NLRP7, also called NALP7 or PYPAF3, is a member of the NOD-like receptors (NLR), a family of proteins that plays a crucial role in the innate immune response. NLRP7 has been reported to emerge from NLRP2 gene. Similar to all inflammasomes, NLRP7 contributes to both pro- and an anti-inflammatory processes, depending on whether it functions in an inflammasome-dependent or independent pathway. The function of NLRP7 inflammasome has also been reported to depend on the master regulatory transcription factor protein that controls cellular inflammation, the NF-kB. In addition to its pro- and anti-inflammatory actions, NLRP7 plays a role in restricting intracellular bacterial replication and can also induce inflammasome assembly upon specific stimulation by FSL-1 (diacylated lipoprotein).

Loading...
||
New chat Able
正在加载,请稍候...