NLRP7 Recombinant monoclonal antibody

• 

  IF Staining of K-562 using 83996-4-RR

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using NLRP7 antibody (83996-4-RR, Clone: 241120A10 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 83996-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83996-4-RR against Human NLRP7 were performed. The affinity constant is 1.98 nM.

NLRP7 Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 83996-4-RR

Clone No.241120A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

NOD12, NALP7, NACHT, LRR and PYD domains-containing protein 7, HYDM, CLR19.4

---

Tested Applications

• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83996-4-RR targets NLRP7 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27465

  Product name: Recombinant human NLRP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC109125

  Sequence: MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTP

• Full Name: NLR family, pyrin domain containing 7
• Calculated Molecular Weight: 112 kDa, 115 kDa, 118 kDa
• GenBank Accession Number: BC109125
• Gene Symbol: NLRP7
• Gene ID (NCBI): 199713
• RRID: AB_3671571
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8WX94
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLRP7, also called NALP7 or PYPAF3, is a member of the NOD-like receptors (NLR), a family of proteins that plays a crucial role in the innate immune response. NLRP7 has been reported to emerge from NLRP2 gene. Similar to all inflammasomes, NLRP7 contributes to both pro- and an anti-inflammatory processes, depending on whether it functions in an inflammasome-dependent or independent pathway. The function of NLRP7 inflammasome has also been reported to depend on the master regulatory transcription factor protein that controls cellular inflammation, the NF-kB. In addition to its pro- and anti-inflammatory actions, NLRP7 plays a role in restricting intracellular bacterial replication and can also induce inflammasome assembly upon specific stimulation by FSL-1 (diacylated lipoprotein).