NMDAR1/GRIN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NMDAR1/GRIN1 Polyclonal antibody, PBS Only (27232-1-PBS)

• 

  WB analysis using 27232-1-AP (same clone as 27232-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27232-1-AP (NMDAR1/GRIN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 27232-1-AP (same clone as 27232-1-PBS)

  IP result of anti-NMDAR1/GRIN1 (IP:27232-1-AP, 4ug; Detection:27232-1-AP 1:400) with rat brain tissue lysate 1120 ug. This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27232-1-AP (same clone as 27232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27232-1-AP (NMDAR1/GRIN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27232-1-AP (same clone as 27232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27232-1-AP (NMDAR1/GRIN1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27232-1-AP (same clone as 27232-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27232-1-AP (NMDAR1/GRIN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 27232-1-AP (same clone as 27232-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using NMDAR1/GRIN1 antibody (27232-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 27232-1-AP (same clone as 27232-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using NMDAR1/GRIN1 antibody (27232-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27232-1-PBS in a different storage buffer formulation.

NMDAR1/GRIN1 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 27232-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

GRIN1, NMDAR1, GluN1, Glutamate receptor ionotropic, NMDA 1, NMDAR 1

---

Product Information

27232-1-PBS targets NMDAR1/GRIN1 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26093

  Product name: Recombinant human NMDAR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-120 aa of NM_000832

  Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG

• Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate 1
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 116-120 kDa
• GenBank Accession Number: NM_000832
• Gene Symbol: NMDAR1
• Gene ID (NCBI): 2902
• RRID: AB_3085939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05586
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831).