CoraLite® Plus 488-conjugated NME1 Recombinant monoclonal antibody

NME1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85038-7
Clone No.242670D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242670D5, AWD, EC:2.7.4.6, GAAD, Granzyme A activated DNase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85038-7 targets NME1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1548

Product name: Recombinant human NME1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC018994

Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Predict reactive species
Full Name non-metastatic cells 1, protein (NM23A) expressed in
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 16-20 kDa
GenBank Accession NumberBC018994
Gene Symbol NME1
Gene ID (NCBI) 4830
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15531
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination.It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...