Product Information
33046-1-PBS targets NME1+NME2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37892 Product name: Recombinant human NME1-NME2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-140 aa of BC107894 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRT Predict reactive species |
| Full Name | NME1-NME2 readthrough transcript |
| Calculated Molecular Weight | 17 kDa / 20 kDa |
| Observed Molecular Weight | 17 kDa, 20 kDa |
| GenBank Accession Number | BC107894 |
| Gene Symbol | NME1-NME2 |
| Gene ID (NCBI) | 654364 |
| RRID | AB_3742835 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P22392 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NME1 and NME2 are associated with metastatic tumor suppression. NME1 and NME2 are multispecificity kinases phosphorylating serine, threonine, histidine, and aspartic acid residues of substrate proteins (PMID: 39032654). NME1 can catalyze the transfer of the terminal phosphate group of nucleoside triphosphates to nucleoside diphosphates to generate nucleoside triphosphates, which is crucial for DNA synthesis and repair. It also participates in cell signal transduction, proliferation, differentiation, and apoptosis. Reduced expression of NME1 is associated with increased tumor metastasis. For instance, in breast cancer, gastric cancer, and other malignancies, restoring NME1 expression can inhibit tumor invasion and metastasis. Similar to NME1, NME2 possesses nucleoside diphosphate kinase activity, participating in nucleotide metabolism and cell signaling regulation. It can form hexameric complexes with NME1 and also exists as homohexamers. Its functions overlap with those of NME1 to some extent but also exhibit unique roles in certain physiological processes. NME2 is involved in tumor metastasis regulation. However, its expression changes and specific mechanisms in different cancers may vary. In some tumors, NME2 expression is downregulated, while in others, it may be upregulated. For example, in hepatocellular carcinoma, reduced NME2 expression is associated with tumor progression and poor prognosis, whereas in ovarian cancer, elevated NME2 expression may promote tumor cell proliferation and metastasis.
