NME3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP01200-3

  The mean NME3 concentration was determined to be 136.5 ng/mL in HEK-293 cell extract based on a 1.5 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP01200-3

  Sandwich ELISA standard curve of MP01200-3, Human NME3 Recombinant Matched Antibody Pair - PBS only. 84278-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag7284. 84278-4-PBS was HRP conjugated as the detection antibody. Range: 3.13-200 ng/mL

• 

  Cytometric bead array standard curve of MP01200-3

  Cytometric bead array standard curve of MP01200-3, NME3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84278-3-PBS. Detection antibody: 84278-4-PBS. Standard: Ag7284. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 84278-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 84278-3-PBS against Human NME3 was performed. The affinity constant is below 1 pM.

NME3 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84278-3-PBS

Clone No.241585G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

84278-3-PBS targets NME3 as part of a matched antibody pair:

MP01200-3: 84278-3-PBS capture and 84278-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7284

  Product name: Recombinant human NME3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-169 aa of BC000250

  Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

• Full Name: non-metastatic cells 3, protein expressed in
• Calculated Molecular Weight: 19 kDa
• GenBank Accession Number: BC000250
• Gene Symbol: NME3
• Gene ID (NCBI): 4832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13232
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.